PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G274300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 413aa    MW: 44559.9 Da    PI: 7.3337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G274300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-171966148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+ Ed+llvd v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Sevir.4G274300.1.p 19 KGPWTQAEDKLLVDHVRRHGEGNWNAVRRETGLQRCGKSCRLRWANHL 66
                        79******************************************9986 PP

2Myb_DNA-binding47.93.2e-1572115146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++++eE+ ++++++ + G++ W++I+++++ gRt++++k++w++
  Sevir.4G274300.1.p  72 KGPFSPEEERQILRLHGLIGNK-WARISSHLP-GRTDNEIKNYWNT 115
                         79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7751466IPR017930Myb domain
SMARTSM007171.6E-131868IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-3018113IPR009057Homeodomain-like
PfamPF002496.6E-151966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-222074IPR009057Homeodomain-like
CDDcd001678.16E-122166No hitNo description
PROSITE patternPS0017503443IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.667121IPR017930Myb domain
SMARTSM007177.2E-1671119IPR001005SANT/Myb domain
PfamPF002491.5E-1472115IPR001005SANT/Myb domain
CDDcd001671.63E-1174117No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2475120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MARSGGGGVE GCGGGVLKKG PWTQAEDKLL VDHVRRHGEG NWNAVRRETG LQRCGKSCRL  60
RWANHLRPNL RKGPFSPEEE RQILRLHGLI GNKWARISSH LPGRTDNEIK NYWNTRLKRR  120
QRAGLPLYPP DIEREIALLR AQNINPFADA DGNANSGLPP PLLYDANNPF ALPPAVPSPS  180
GSATASHSPL INQSYPLLNQ MQGMPVFHLA SSQQSPQPVF HHHQDNGAAL GHGGFVSSGL  240
PPLPTRAHEL PSNQFDTSSS GGGAGLLESL LLGDDHLPRH IPTMVKVNSM PALTYREPGS  300
CRLPVHGAGA GSDSDETSHC LPGEDMHHGA KWNFTYEDFK PAKRRTPSEA GISDMFGVAP  360
GFIPGDWFSA CGGSTAPSPG PSSAVTDDEF GLEMQQFMSL LPLSIDEHSW NA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29171205107B-MYB
1h8a_C9e-291712025127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3738041e-158AK373804.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3044A21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966213.10.0PREDICTED: uncharacterized protein LOC101767992 isoform X1
TrEMBLK3XX970.0K3XX97_SETIT; Uncharacterized protein
STRINGSi006555m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.15e-59myb domain protein 33